Brennstoffzellen

Ultraschall-Sprühsysteme zur Beschichtung von Brennstoffzellenkomponenten

 

brennstoffzellen
Brennstoffzellen

Bilder »

FlexiCoat™ & ExactaCoat™ Programmierbare XYZ Systeme

Sono-Tek Ultraschall Beschichtungsanlagen mit XYZ Bewegung bieten einzigartige Optionen, die kundenspezifische Anpassungen der Maschinen auf Basis spezieller Prozessanforderungen erlauben. Sie sind ideal zur Solar- und Brennstoffzellenbeschichtung sowie zur Entwicklung von Beschichtungen in unterschiedlichen Umgebungen, wie zum Beispiel bei Schutzgasatmosphäre, hohen Temperaturen oder rotierender Z-Achse für röhrenförmige Substrate. Alle Anlagen werden über Windows-basierte PathMaster Software gesteuert und verfügen über ein bedienerfreundliches Programmierhandgerät mit Steuerkugel (Trackball).

FlexiCoat FC-R für die Beschichtung von Festoxidbrennstoffzellenröhren (SOFC) mit Keramikmaterial oder Metalloxidsuspensionen wie Nickeloxid.

ExactaCoat FC ist ein Laborgerät für FuE und Kleinserienproduktion zur Beschichtung
von Protonenaustauschmembranen (PEM) oder anderem Elektrolytmaterial mit Katalysatortinten. Diese extrem dünnen Beschichtungen erfordern das Aufbringen mehrer Lagen, um die erforderliche Applikationsmenge der Tinten zu erreichen, ohne die empfindlichen Membranen zu deformieren. Sono-Tek hat Beschichtungsprozesse entwickelt, die sehr gute Ergebnisse mit haltbaren, Pinhole-freien Beschichtungen zeigen.

FlexiCoat FC ist eine Beschichtungsanlage für die Kleinproduktion mit erweiterten Funktionen für die Applikation von Katalysatorschichten auf GDLs oder
Brennstoffzellenmembranen. HyperSonic ist ein robustes, einachsiges Hochgeschwindigkeitsverfahrsystem zur Adaption eines Laborprozesses in die Großserien Produktion.

Optionen

Verfügbare Optionen für XYZ-Systeme sind

  • Heiz- und/oder Vakuumplatte
  • Kamera
  • Laserpointer
  • Substratbefestigung

  • Zweifachdüsenkonfiguration
  • SMEMA Fördersysteme
  • Programmierbare Neigung der Düse
  • Lösungsmittelerkennungssystem

Bilder